- VPS51 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-90857
- Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin
- VPS51
- This antibody was developed against Recombinant Protein corresponding to amino acids: FDPEVYLDKL RRECPLAQLM DSETDMVRQI RALDSDMQTL VYENYNKFIS ATDTIRKMKN DFRKMEDEMD RLATNMAVIT DFS
- ANG2, ANG3, C11orf2, C11orf3, FFR, PCH13
- Human, Mouse, Rat
- 0.1 ml (also 25ul)
- Unconjugated
- PBS (pH 7.2) and 40% Glycerol
- Rabbit
- VPS51 subunit of GARP complex
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Signal Transduction
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
FDPEVYLDKLRRECPLAQLMDSETDMVRQIRALDSDMQTLVYENYNKFISATDTIRKMKNDFRKMEDEMDRLATNMAVITDFS
Specifications/Features
Available conjugates: Unconjugated